Name: Sermorelin – Growth Hormone Releasing Hormone Analog – 2mg
Brand: CertPeptides
SKU: CP-SERM-2MG
Price: 34.99 USD
Availability: InStock

Product Description

Sermorelin is a synthetic analog of growth hormone-releasing hormone (GHRH) consisting of the first 29 amino acids of the 44-amino acid native GHRH sequence. It retains full biological activity at the GHRH receptor and is widely used in research investigating the hypothalamic-pituitary-somatotropic axis.

Specifications

Molecular Weight	3357.96 g/mol
Purity	≥99% (HPLC)
Physical Form	Lyophilized powder
Storage	-20°C, keep away from light and moisture

Research Applications

Growth hormone secretion and pulsatility studies
Hypothalamic-pituitary axis research
Age-related GH decline investigation
GHRH receptor signaling mechanisms

Disclaimer: This product is intended for laboratory and research use only. Not for human or animal consumption. All handling should be conducted by qualified researchers in accordance with applicable regulations.

Certificate of Analysis

Every batch of Sermorelin sold by CertPeptides is independently tested by a third-party laboratory. The Certificate of Analysis (COA) confirms identity, purity (≥99% via HPLC), and the absence of heavy metals and microbial contamination.

A COA is included with every order. You may also request a batch-specific COA through our contact page.

Laboratory Product Information

📦 Includes

One (1) vial of Sermorelin lyophilized powder (2mg per vial), Certificate of Analysis (COA).

🔬 Purpose

Sermorelin is a synthetic 29-amino-acid peptide corresponding to the first 29 residues of human GHRH (GHRH 1–29 NH₂). It is the minimal fully active fragment of GHRH and is used in in-vitro GHRH receptor binding assays, cAMP signaling studies, and somatotroph cell function models.

🧬 Ingredients

Sermorelin (GHRH 1–29 NH₂) 29-amino-acid peptide lyophilized powder, ≥99% purity (HPLC verified). No fillers, binders, or excipients.

🔬 Laboratory Handling Information

Molecular Formula: C₁₄₉H₂₄₆N₄₄O₄₂S
Molecular Weight: ~3357.93 Da
Amino Acid Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH₂ (YADAIFTNSYRKVLGQLSARKLLQDIMSRQ; 29 residues, C-terminal amide)
Solubility: Soluble in sterile aqueous buffers (e.g., bacteriostatic water, PBS) at concentrations suitable for in-vitro applications
Storage: Store lyophilized product at 2–8°C; reconstituted aliquots at −20°C; avoid repeated freeze-thaw cycles
Literature Reference: Referenced at 1–100 nM for in-vitro GHRH receptor binding and cAMP signaling assays (PubMed: Prakash & Goa, BioDrugs, 1999)

🚨 IMPORTANT — RESEARCH USE ONLY

FOR RESEARCH USE ONLY – NOT FOR HUMAN OR VETERINARY CONSUMPTION. Not intended for any in vivo use, therapeutic, or diagnostic purpose. No dosing or administration information provided or implied.

🚚 Shipping

Ships in temperature-controlled packaging via priority courier. Most orders ship within 24 hours on business days. Free shipping on orders over $150. Tracking number provided via email upon shipment.

Sermorelin – Growth Hormone Releasing Hormone Analog – 2mg