🔬 FREE Shipping on Orders Over $150  |  All Peptides Include COA  |  For Research Use Only  |  @CertPeptides

Tesamorelin – 10mg

Tesamorelin – 10mg
Growth Hormone

Tesamorelin – 10mg

$69.99

Tesamorelin is a synthetic analog of growth hormone-releasing hormone (GHRH) with a trans-3-hexenoic acid modification. It stimulates pituitary GH secretion and has been studied for its effects on visceral adipose tissue reduction, lipodystrophy, and metabolic biomarkers.

Molecular Weight:5135.89 g/mol
Sequence:44 amino acid modified GHRH(1-44)
Purity:≥99% (HPLC)
Form:Lyophilized powder
Storage:-20°C
✔ Third-Party Tested
✔ COA Included
✔ 99%+ Purity
✔ Fast Shipping

Product Description

Tesamorelin is a synthetic analog of growth hormone-releasing hormone (GHRH) with a trans-3-hexenoic acid modification. It stimulates pituitary GH secretion and has been studied for its effects on visceral adipose tissue reduction, lipodystrophy, and metabolic biomarkers.

Specifications

Molecular Weight 5135.89 g/mol
Sequence 44 amino acid modified GHRH(1-44)
Purity ≥99% (HPLC)
Physical Form Lyophilized powder
Storage -20°C, keep away from light and moisture

Research Applications

  • Growth hormone secretion and pulsatility studies
  • Visceral adipose tissue reduction research
  • Lipodystrophy and metabolic biomarker studies
  • IGF-1 elevation and body composition research

Disclaimer: This product is intended for laboratory and research use only. Not for human or animal consumption. All handling should be conducted by qualified researchers in accordance with applicable regulations.

Certificate of Analysis

Every batch of Tesamorelin sold by CertPeptides is independently tested by a third-party laboratory. The Certificate of Analysis (COA) confirms identity, purity (≥99% via HPLC), and the absence of heavy metals and microbial contamination.

A COA is included with every order. You may also request a batch-specific COA through our contact page.

Laboratory Product Information

📦 Includes

One (1) vial of Tesamorelin lyophilized powder (10mg per vial), Certificate of Analysis (COA).

🔬 Purpose

Tesamorelin is a synthetic 44-amino-acid analog of human GHRH with a trans-3-hexenoic acid modification at the N-terminal tyrosine. It is used in in-vitro GHRH receptor binding assays and cAMP signaling studies to characterize the enhanced receptor affinity conferred by the lipophilic modification.

🧬 Ingredients

Tesamorelin (trans-3-hexenoic acid modified GHRH 1–44 NH₂) 44-amino-acid peptide lyophilized powder, ≥98% purity (HPLC verified). No fillers, binders, or excipients.

🔬 Laboratory Handling Information

  • Molecular Formula: C₂₂₁H₃₆₆N₇₂O₆₇S (approximate; includes trans-3-hexenoic acid modification)
  • Molecular Weight: ~5135.88 Da
  • Amino Acid Sequence: (trans-3-Hexenoic acid)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH₂ (44 residues, C-terminal amide, N-terminal hexenoic acid modification)
  • Solubility: Soluble in sterile aqueous buffers (e.g., bacteriostatic water, PBS) at concentrations suitable for in-vitro applications
  • Storage: Store lyophilized product at 2–8°C; reconstituted aliquots at −20°C; avoid repeated freeze-thaw cycles
  • Literature Reference: Referenced at 1–100 nM for in-vitro GHRH receptor binding and cAMP signaling assays (PubMed: Dhillon, Drugs, 2011)

🚨 IMPORTANT — RESEARCH USE ONLY

FOR RESEARCH USE ONLY – NOT FOR HUMAN OR VETERINARY CONSUMPTION. Not intended for any in vivo use, therapeutic, or diagnostic purpose. No dosing or administration information provided or implied.

🚚 Shipping

Ships in temperature-controlled packaging via priority courier. Most orders ship within 24 hours on business days. Free shipping on orders over $150. Tracking number provided via email upon shipment.